PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G05010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 329aa    MW: 35594.9 Da    PI: 5.4489
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G05010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.7e-5191331128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtd+elv++yL++k+ g +l +  vi+evd+yk++PwdLp+++ ++ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+v s
  OGLUM11G05010.1   9 LPPGFRFHPTDDELVMYYLCRKCGGLPLAA-PVIAEVDLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGS 101
                      79*************************999.89***************8888999*************************************99 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v +kk Lvfy g+ pkg+kt+W+mheyrl
  OGLUM11G05010.1 102 --PRAVAIKKALVFYAGKPPKGVKTNWIMHEYRL 133
                      ..678***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-615166IPR003441NAC domain
PROSITE profilePS5100558.6669166IPR003441NAC domain
PfamPF023659.6E-2610133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MECGGALQLP PGFRFHPTDD ELVMYYLCRK CGGLPLAAPV IAEVDLYKFN PWDLPERAMG  60
GEKEWYFFSP RDRKYPNGQR PNRAAGTGYW KATGADKPVG SPRAVAIKKA LVFYAGKPPK  120
GVKTNWIMHE YRLADVDRSA AARKLSKSSH NALRLDDWVL CRIYNKKGVI ERYDTVDAVE  180
DVKPATAAAA AAAKGGRIGG GAAAMKVELS DYGFYDQEPE SEMLCFDRSG SADRDSMPRL  240
HTDSSGSEHV LSPSPSPDDF PGGGDHDYAE SQPSGGCGGW PGVDWAAVGD DGFVIDSSLF  300
ELPSPAAFSR GGGDGAAFGD MFTYLQKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-77717213174Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194200GGRIGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281840.0AB028184.1 Oryza sativa mRNA for OsNAC5 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617286.10.0PREDICTED: NAC domain-containing protein 71
SwissprotQ53NF70.0NAC71_ORYSJ; NAC domain-containing protein 71
TrEMBLA0A0D3HJ090.0A0A0D3HJ09_9ORYZ; Uncharacterized protein
TrEMBLI1QYA80.0I1QYA8_ORYGL; Uncharacterized protein
TrEMBLA0A0E0BG510.0A0A0E0BG51_9ORYZ; Uncharacterized protein
STRINGORGLA11G0050000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118043039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.15e-92NAC domain containing protein 32